ADH1B anticorps

N° du produit ABIN632493

Cet anticorps anti-ADH1B est un anticorps Lapin Polyclonal détectant ADH1B dans WB. Adapté pour Humain.

Aperçu rapide pour ADH1B anticorps (ABIN632493)

Antigène: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADH1B anticorps

Purification: Affinity purified

Immunogène: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH1B Blocking Peptide, (ABIN5611949), is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH1B

Antigène: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Autre désignation: ADH1B

Sujet: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Poids moléculaire: 40 kDa (MW of target protein)